AibGenesis™ Mouse Anti-lypd6b Antibody (CBMOAB-85633FYA)


Cat: CBMOAB-85633FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
  • Reference
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-85633FYA Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO85633FYA 100 µg
MO-AB-04201W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04201W 100 µg
MO-AB-19944W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19944W 100 µg
MO-AB-26910H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26910C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO85633FYA
SpecificityThis antibody binds to Zebrafish lypd6b.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish lypd6b Antibody is a mouse antibody against lypd6b. It can be used for lypd6b detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Nameslypd6b
UniProt IDB0S8J0
Protein RefseqThe length of the protein is 190 amino acids long.
The sequence is show below: MNRQLFQHMFYAADALPGVTNSVSNMAVSNFVSVLVLLLVNLVTSENIDFYNLRPAIEATPYPKSFKCFTCEQASDNYSCNRWAEDVWCPQNTQYCMTIHHFNHHGKTKFVTKRCAVRDECRLAGCRHHKNTHHECVSCCEGMVCNVELPTNHSNAVFAQRRAHSSASATFRSWHSVILLIPALSGLMPL.

Reference

Reference1. Özhan, G., Sezgin, E., Wehner, D., Pfister, A. S., Kühl, S. J., Kagermeier-Schenk, B., ... & Weidinger, G. (2013). Lypd6 enhances Wnt/β-catenin signaling by promoting Lrp6 phosphorylation in raft plasma membrane domains. Developmental cell, 26(4), 331-345.
2. Zhao, Y., Ren, J., Lu, W., Harlos, K., & Jones, E. Y. (2018). Structure of the Wnt signaling enhancer LYPD 6 and its interactions with the Wnt coreceptor LRP 6. FEBS letters, 592(18), 3152-3162.
For Research Use Only | Not For Clinical Use.
Online Inquiry