AibGenesis™ Mouse Anti-Mad Antibody (CBMOAB-23386FYA)


Cat: CBMOAB-23386FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-23386FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO23386FYA 100 µg
MO-DKB-03100W Polyclonal Fruit fly (Drosophila melanogaster) ELISA, IMM, WB 100 µg
MO-DKB-03104W Polyclonal Fruit fly (Drosophila melanogaster) ELISA, IF, WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO23386FYA
SpecificityThis antibody binds to fruit fly Mad.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRequired for the function of decapentaplegic. May play an important role in mediating Dpp signaling. Involved in the BMP signaling pathway. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Mad Antibody is a mouse antibody against Mad. It can be used for Mad detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMothers against decapentaplegic homolog; MAD homolog; Mothers against DPP homolog; SMAD family member; Mad
UniProt IDM9PBX0
Protein RefseqThe length of the protein is 525 amino acids long.
The sequence is show below: MYYPPADSYTGYRVTPPQINGGTTTTTTISSGSSNNNNIHHINNNNNHICSSGSSNNLNLTTAISGSSNRMDTDDVESNTSSAMSTLGSLFSFTSPAVKKLLGWKQGDEEEKWAEKAVDSLVKKLKKRKGAIEELERALSCPGQPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLELCQYPFSAKQKEVCINPYHYKRVESPVLPPVLVPRHSEFAPGHSMLQFNHVAEPSMPHNVSYSNSGFNSHSLSTSNTSVGSPSSVNSNPNSPYDSLAGTPPPAYSPSEDGNSNNPNDGGQLLDAQMGDVAQVSYSEPAFWASIAYYELNCRVGEVFHCNNNSVIVDGFTNPSNNSDRCCLGQLSNVNRNSTIENTRRHIGKGVHLYYVTGEVYAECLSDSAIFVQSRNCNYHHGFHPSTVCKIPPGCSLKIFNNQEFAQLLSQSVNNGFEAVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNAISSVS.
For Research Use Only | Not For Clinical Use.
Online Inquiry