AibGenesis™ Mouse Anti-MADS5 Antibody (CBMOAB-34586FYB)


Cat: CBMOAB-34586FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-34586FYB Monoclonal Rice (Oryza), Maize (Zea mays), Rice WB, ELISA MO34586FYB 100 µg
MO-AB-48665W Monoclonal Maize (Zea mays) WB, ELISA MO48665W 100 µg
MO-MMB-0300 Polyclonal Rice ELISA, WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), Maize (Zea mays), Rice
CloneMO34586FYB
SpecificityThis antibody binds to Rice MADS5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionProbable transcription factor. May be involved in the control of flowering time. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rice MADS5 Antibody is a mouse antibody against MADS5. It can be used for MADS5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMADS-box transcription factor 5; FDRMADS2; OsMADS5; MADS5; Os06g0162800 LOC_Os06g06750
UniProt IDQ0DEB8
Protein RefseqThe length of the protein is 225 amino acids long.
The sequence is show below: MGRGKVELKRIENKISRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGRLFEFSTSSCMYKTLERYRSCNYNLNSCEASAALETELSNYQEYLKLKTRVEFLQTTQRNLLGEDLVPLSLKELEQLENQIEISLMNIRSSKNQQLLDQVFELKRKEQQLQDANKDLKRKIQETSGENMLHISCQDVGPSGHASEANQEFLHHAICDPSLHIGYQAYMDHLNQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry