AibGenesis™ Mouse Anti-MAGEL2 Antibody (CBMOAB-49467FYA)


Cat: CBMOAB-49467FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-49467FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Pig (Sus scrofa) WB, ELISA MO49467FYA 100 µg
MO-AB-15255R Monoclonal Cattle (Bos taurus) WB, ELISA MO15255R 100 µg
MO-AB-27101R Monoclonal Pig (Sus scrofa) WB, ELISA MO27101R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Pig (Sus scrofa)
CloneMO49467FYA
SpecificityThis antibody binds to Rhesus MAGEL2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus MAGEL2 Antibody is a mouse antibody against MAGEL2. It can be used for MAGEL2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMAGE-like protein 2; MAGEL2
UniProt IDH9FDE6
Protein RefseqThe length of the protein is 152 amino acids long.
The sequence is show below: SKERRAPSKDRMIFAATFCAPKAVSAARAHLPGTWKNLPATPETFAPSSSVFPATSQFQPASLNAFKGPSAASEAPKSLPYALQDPFACAEALPAVPWAPQPNMNASKASQAVPTLLMATAAAPQATATTQEASKTSVEMPRRSGKATRKKK.
For Research Use Only | Not For Clinical Use.
Online Inquiry