Mouse Anti-Maize Atg10 Antibody (MO-AB-47411W)


Cat: MO-AB-47411W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMaize (Zea mays)
CloneMO47411W
SpecificityThis antibody binds to Maize Atg10.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAutophagy is a process for the bulk degradation of cytosolic compartments by lysosomes. ATG10 is an E2-like enzyme involved in 2 ubiquitin-like modifications essential for autophagosome formation: ATG12 (MIM 609608)-ATG5 (MIM 604261) conjugation and modification of a soluble form of MAP-LC3 (MAP1LC3A; MIM 601242), a homolog of yeast Apg8, to a membrane-bound form (Nemoto et al., 2003 [PubMed 12890687]).
Product OverviewMouse Anti-Maize Atg10 Antibody is a mouse antibody against Atg10. It can be used for Atg10 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAutophagy 10 variant 1; Autophagy-related 10 variant 1; Atg10; Zm.85709
UniProt IDB8XVR1
Protein RefseqThe length of the protein is215 amino acids long.
The sequence is show below: MGGSPVWDGTLSPDSFNTSAAALVKRWKEIEVDDSLPEWTWKPCSKLGVPSEVEGYLALERVYRSCGTSQEQIEEMKFDGAGDVAWVESSSDNVHVYDFHAVYSFSYKVPVLYFRGYHTSGQLLTLDEVKEGLPSHSQKVLSESKWTFITQEEHPHLSKPWLALHPCATSGWMKLLLEETEATDKEHSVQYLPAWLSVVGQAVGLKIPLELHSNS.
For Research Use Only | Not For Clinical Use.
Online Inquiry