Mouse Anti-Maize vdac2 Antibody (MO-AB-49803W)


Cat: MO-AB-49803W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMaize (Zea mays)
CloneMO49803W
SpecificityThis antibody binds to Maize vdac2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the voltage-dependent anion channel pore-forming family of proteins that are considered the main pathway for metabolite diffusion across the mitochondrial outer membrane. The encoded protein is also thought to be involved in the mitochondrial apoptotic pathway via regulation of BCL2-antagonist/killer 1 protein activity. Pseudogenes have been identified on chromosomes 1, 2, 12 and 21, and alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Maize vdac2 Antibody is a mouse antibody against vdac2. It can be used for vdac2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOuter mitochondrial membrane protein porin; Voltage-dependent anion channel protein 2; vdac2
UniProt IDQ9SPD7
Protein RefseqThe length of the protein is276 amino acids long.
The sequence is show below: MAAAGPGLYSEIGKKARDLLYKDYHTDQKFTLTTYAANGAAITAASTRKDEAIFNEIQSQLKHNNVTVDVKATSESNVITTITVHELGTPGLKAILCVPFPYQKSAKAELQYLHHHAGVAASVGLNANPVVNLSGVFGTKAIAVGADAAFDTSSGDLTKYNAGLSYTTPDFVAAATLNNKGDNIAASYYHSVSPTTAVGGELSHSFSTNGNTITFGTQHALDPLTTVKARFNNYGMASALIQHEWRPKSLVTISTEVDTKAIEKSSKVGLSLVLKP.
For Research Use Only | Not For Clinical Use.
Online Inquiry