Mouse Anti-Marmoset VDAC2 Antibody (MO-AB-67650W)


Cat: MO-AB-67650W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset
CloneMO67650W
SpecificityThis antibody binds to Marmoset VDAC2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Mitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the voltage-dependent anion channel pore-forming family of proteins that are considered the main pathway for metabolite diffusion across the mitochondrial outer membrane. The encoded protein is also thought to be involved in the mitochondrial apoptotic pathway via regulation of BCL2-antagonist/killer 1 protein activity. Pseudogenes have been identified on chromosomes 1, 2, 12 and 21, and alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Marmoset VDAC2 Antibody is a mouse antibody against VDAC2. It can be used for VDAC2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesVoltage-dependent anion-selective channel protein 2 isoform 2; VDAC2
UniProt IDF7I2M8
Protein RefseqThe length of the protein is 294 amino acids long.
The sequence is show below: MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRSNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEGLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKLGLALELEA.
For Research Use Only | Not For Clinical Use.
Online Inquiry