Mouse Anti-Mallard CLIC3 Antibody (MO-AB-23055H)
Cat: MO-AB-23055H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Mallard (Anas platyrhynchos) |
Clone | MO23055C |
Specificity | This antibody binds to Mallard CLIC3. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 3 is a member of the p64 family and is predominantly localized in the nucleus and stimulates chloride ion channel activity. In addition, this protein may participate in cellular growth control, based on its association with ERK7, a member of the MAP kinase family. |
Product Overview | This product is a mouse antibody against CLIC3. It can be used for CLIC3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Cleft lip and palate transmembrane protein 1-like protein; CLIC3 |
UniProt ID | U3IBD3 |
Protein Refseq | The length of the protein is 237 amino acids long. The sequence is show below: MDVRLDREHKVGGLLPRPTFTDKSTYIESSTKVYDDXRCEWLWGLP. |
See other products for " clic3 "
MO-AB-02465H | Mouse Anti-Frog clic3 Antibody (MO-AB-02465H) |
MO-AB-10341R | Mouse Anti-Cattle CLIC3 Antibody (MO-AB-10341R) |
MO-AB-53146W | Mouse Anti-Marmoset CLIC3 Antibody (MO-AB-53146W) |
CBMOAB-39384FYA | Mouse Anti-Rhesus CLIC3 Antibody (CBMOAB-39384FYA) |
MO-AB-24880H | Mouse Anti-Rat Clic3 Antibody (MO-AB-24880H) |
MO-AB-11867W | Mouse Anti-Chimpanzee CLIC3 Antibody (MO-AB-11867W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry