Mouse Anti-Rat Clic3 Antibody (MO-AB-24880H)


Cat: MO-AB-24880H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO24880C
SpecificityThis antibody binds to Rat Clic3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Nucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionChloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 3 is a member of the p64 family and is predominantly localized in the nucleus and stimulates chloride ion channel activity. In addition, this protein may participate in cellular growth control, based on its association with ERK7, a member of the MAP kinase family.
Product OverviewThis product is a mouse antibody against Clic3. It can be used for Clic3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesChloride intracellular channel 3; Protein Clic3; Clic3
UniProt IDD3ZY91
Protein RefseqThe length of the protein is 237 amino acids long.
The sequence is show below: MAETTKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRALDVLKDFAPGSQLPILLYDGDVKTDTLQIEEFLEETLGPPDFPGLAPRYRESNTAGNDIFHKFSAFIKNPVPTQDDALYQQLLRALTRLDRYLGTPLDHELAQEPHLSESRRRFLDGDQLTLADCSLLPKLHIVDTVCAHFRQRPIPAELSCVRRYLDSALQEKEFKYTCPHSAEILAAYQPAVHPR.
For Research Use Only | Not For Clinical Use.
Online Inquiry