AibGenesis™ Mouse Anti-MARCH2 Antibody (MO-AB-25770W)


Cat: MO-AB-25770W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-25770W Monoclonal Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO25770W 100 µg
MO-AB-26970H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26970C 100 µg
MO-AB-58734W Monoclonal Marmoset WB, ELISA MO58734W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO25770W
SpecificityThis antibody binds to Chimpanzee MARCH2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Chimpanzee MARCH2 Antibody is a mouse antibody against MARCH2. It can be used for MARCH2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMembrane-associated ring finger (C3HC4) 2; MARCH2
UniProt IDK7CAH2
Protein RefseqThe length of the protein is 246 amino acids long.
The sequence is show below: MTTGDCCHLPGSLCDCSGSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALDTPSDGPFCRICHEGANGECLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEWLKDPGPRTEKRTLCCDMVCFLFITPLAAISGWLCLRGAQDHLRLHSQLEAVGLIALTIALFTIYVLWTLVSFRYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSPLAAGLLKKVAEETPV.
For Research Use Only | Not For Clinical Use.
Online Inquiry