AibGenesis™ Mouse Anti-MARCHF2 Antibody (MO-AB-15367R)


Cat: MO-AB-15367R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-15367R Monoclonal Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO15367R 100 µg
MO-AB-26971H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26971C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO15367R
SpecificityThis antibody binds to Cattle MARCHF2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Lysosome; Endosome; Endoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle MARCHF2 Antibody is a mouse antibody against MARCHF2. It can be used for MARCHF2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesE3 ubiquitin-protein ligase MARCH2; EC 6.3.2.-; Membrane-associated RING finger protein 2; Membrane-associated RING-CH protein II; MARCH-II; MARCH2
UniProt IDQ32L65
Protein RefseqThe length of the protein is 245 amino acids long.
The sequence is show below: MTTGDCCHLPGSLCDCSDSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALETPSDGPFCRICHEGANGESLLSPCGCSGTLGAVHKSCLERWLSSSNTSYCELCHTEFAVEKRSRSLTEWLKDPGPRTEKRTLCCDVVCFLFITPLAAISGWLCLRGAQDHLRLHSHLEALGLIALTIALFTIYVLWTLVSFRYHCQLYSEWRRTNQKVRLKMQADGSEGSQHSPLAAGLLKKVAEETPV.
For Research Use Only | Not For Clinical Use.
Online Inquiry