Mouse Anti-Marmoset CASP4 Antibody (MO-AB-52286W)


Cat: MO-AB-52286W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset
CloneMO52286W
SpecificityThis antibody binds to Marmoset CASP4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes composed of a prodomain and a large and small protease subunit. Activation of caspases requires proteolytic processing at conserved internal aspartic residues to generate a heterodimeric enzyme consisting of the large and small subunits. This caspase is able to cleave and activate its own precursor protein, as well as caspase 1 precursor. When overexpressed, this gene induces cell apoptosis. Alternative splicing results in transcript variants encoding distinct isoforms.
Product OverviewMouse Anti-Marmoset CASP4 Antibody is a mouse antibody against CASP4. It can be used for CASP4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCaspase; CASP4
UniProt IDU3BUJ4
Protein RefseqThe length of the protein is 377 amino acids long.
The sequence is show below: MAEGNQRKKTLKMWESWGKGVLTGALDDLVEQDVLNWKEEDKKKYYDAKTKDKVRVVADSMKKNQRMAGKMLLNTFFNIDQISPKKTGNSNMAVGPPETGESTDALKLCPHEEFLRLCTEKAEEIYPIKERKDRTRLALIICNTEFDHLPPRHGADFDITGMRELLEGLDYSVVVEEKLTARGMESVLRAFAARPEHKSSDSTFLVLMSHGILEGICGTAHDDKNPDVLLYDTIFQIFNNRNCLGLRDKPKVIIVQACRGTNQGDLLVPDAPASLAVASSQSLKNLEEDAIHKTHVEKDFIAFCSSTPHNVSWRDSTVGSIFITQLVACFRKYSWCCHLEEVFRKVQQSFETPRDKAQMPTIERLSMTRYFYLFPGN.
For Research Use Only | Not For Clinical Use.
Online Inquiry