Mouse Anti-Marmoset ECM1 Antibody (MO-AB-54673W)


Cat: MO-AB-54673W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset
CloneMO54673W
SpecificityThis antibody binds to Marmoset ECM1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a soluble protein that is involved in endochondral bone formation, angiogenesis, and tumor biology. It also interacts with a variety of extracellular and structural proteins, contributing to the maintenance of skin integrity and homeostasis. Mutations in this gene are associated with lipoid proteinosis disorder (also known as hyalinosis cutis et mucosae or Urbach-Wiethe disease) that is characterized by generalized thickening of skin, mucosae and certain viscera. Alternatively spliced transcript variants encoding distinct isoforms have been described for this gene.
Product OverviewMouse Anti-Marmoset ECM1 Antibody is a mouse antibody against ECM1. It can be used for ECM1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesExtracellular matrix protein 1 isoform 1; ECM1
UniProt IDU3D3L5
Protein RefseqThe length of the protein is 544 amino acids long.
The sequence is show below: MGTTARAALVLAYLAVASAASEGGFETAGQGQLRPEHIMQHFQEVGYAAPPSPPLSRSLPVDHPDTSQHGPPFEEQKEMQPCQDTTPVQQEELLPSRFPAEKEVQDGSPLPQEAVPLQQEPLSLQHPSEQKEGTPAPFGNQNLPEPESWNAAQHCRQGRSRGGWGHRLDGFPPGRPSPDNLNQICLPDRQHVVYGPWNLPQSGYSHLSRQGETLNFLETGYSRCCHCRSHTNRLECAKLVWEDTMSRFCEAEFSVKTRPHWCCTRQGEARFSCFQEEAPQPHYQLQPCPSHQPDISSGLELPFPPGAPTLDNIKNICHLRRFSSVPRHLPATDPLRRQLLALTRLEREFQRCCRQGSNHTCTWKAWEDTLDKYCDQEYAIKTHHHSCCHYPPSPTRDECFASRAPYPNYDRDILTIDISQVTPNLMGHLCGNHRVLTKHKHIPGLIHNMTARCCDLPFPEQACCAEEEKLTFINDLCGPRRNFWRDPALCCYLSPGDEQVNCFNINYLRNVALVAGDTENSKGQGEQGPTGGTNISSTSEPKEE.
For Research Use Only | Not For Clinical Use.
Online Inquiry