Mouse Anti-Marmoset GSTO1 Antibody (MO-AB-56470W)


Cat: MO-AB-56470W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset
CloneMO56470W
SpecificityThis antibody binds to Marmoset GSTO1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is an omega class glutathione S-transferase (GST) with glutathione-dependent thiol transferase and dehydroascorbate reductase activities. GSTs are involved in the metabolism of xenobiotics and carcinogens. The encoded protein acts as a homodimer and is found in the cytoplasm. Three transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Marmoset GSTO1 Antibody is a mouse antibody against GSTO1. It can be used for GSTO1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGlutathione S-transferase omega-1 isoform 1; LOC100399847; GSTO1
UniProt IDF7BC21
Protein RefseqThe length of the protein is 241 amino acids long.
The sequence is show below: MSGESARSLGKGSAPPGPVPEGLIRVYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLFPDDPYEKACQKMVFELFSKVPSLVGSFIRSQNKEDCAGLKEEFRKEFSKLEKVLTNKKTTFFGGSSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSVKDWQGFLELYLQNSPEACDYGL.
See other products for " gsto1 "
CBMOAB-78842FYAMouse Anti-Zebrafish gsto1 Antibody (CBMOAB-78842FYA)
MO-DKB-00861WRabbit Anti-GSTO1 Antibody (MO-DKB-00861W)
CBMOAB-00077HCBMouse Anti-C. elegans GSTO1 Antibody (CBMOAB-00077HCB)
MO-AB-04097HMouse Anti-Frog gsto1 Antibody (MO-AB-04097H)
CBMOAB-44212FYAMouse Anti-Rhesus GSTO1 Antibody (CBMOAB-44212FYA)
MO-AB-26161HMouse Anti-Rat Gsto1 Antibody (MO-AB-26161H)
CBMOAB-18306FYAMouse Anti-D. melanogaster Gsto1 Antibody (CBMOAB-18306FYA)
MO-AB-13411RMouse Anti-Cattle GSTO1 Antibody (MO-AB-13411R)
MO-AB-11556YMouse Anti-O. mykiss GSTO1 Antibody (MO-AB-11556Y)
CBMOAB-60166FYCMouse Anti-Rhesus GSTO1 Antibody (CBMOAB-60166FYC)
For Research Use Only | Not For Clinical Use.
Online Inquiry