Mouse Anti-Marmoset MPC1 Antibody (MO-AB-59245W)


Cat: MO-AB-59245W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset
CloneMO59245W
SpecificityThis antibody binds to Marmoset MPC1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is part of an MPC1/MPC2 heterodimer that is responsible for transporting pyruvate into mitochondria. The encoded protein is found in the inner mitochondrial membrane. Defects in this gene are a cause of mitochondrial pyruvate carrier deficiency. Several transcript variants, some protein coding and one non-protein coding, have been found for this gene.
Product OverviewMouse Anti-Marmoset MPC1 Antibody is a mouse antibody against MPC1. It can be used for MPC1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMitochondrial pyruvate carrier 1 isoform 1; MPC1
UniProt IDU3DHI0
Protein RefseqThe length of the protein is 109 amino acids long.
The sequence is show below: MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALCCYSLTFMRFAYKVQPRNWLLFACHATNEVAQLIQGGRLIKYEMSKKASA.
For Research Use Only | Not For Clinical Use.
Online Inquiry