Mouse Anti-Zebrafish mpc1 Antibody (CBMOAB-87234FYA)


Cat: CBMOAB-87234FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO87234FYA
SpecificityThis antibody binds to Zebrafish mpc1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is part of an MPC1/MPC2 heterodimer that is responsible for transporting pyruvate into mitochondria. The encoded protein is found in the inner mitochondrial membrane. Defects in this gene are a cause of mitochondrial pyruvate carrier deficiency. Several transcript variants, some protein coding and one non-protein coding, have been found for this gene.
Product OverviewMouse Anti-Zebrafish mpc1 Antibody is a mouse antibody against mpc1. It can be used for mpc1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:92707; mpc1; zgc:9270
UniProt IDQ6DGZ7
Protein RefseqThe length of the protein is 109 amino acids long.
The sequence is show below: MAATLARKAVDHLRSKEFRDYLMSTHFWGPVANWGLPIAAISDMRKSPEIISGRMTFALTCYSLLFMRFAYKVQPRNWLLFACHFTNEGAQLIQGSRLIKYNMEKKMAK.
For Research Use Only | Not For Clinical Use.
Online Inquiry