Mouse Anti-Marmoset RPE Antibody (MO-AB-63496W)


Cat: MO-AB-63496W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset
CloneMO63496W
SpecificityThis antibody binds to Marmoset RPE.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRPE (Ribulose-5-Phosphate-3-Epimerase) is a Protein Coding gene. Diseases associated with RPE include 3-Methylglutaconic Aciduria, Type Iii. Among its related pathways are Glycosaminoglycan metabolism and Pentose phosphate pathway. Gene Ontology (GO) annotations related to this gene include protein homodimerization activity and racemase and epimerase activity, acting on carbohydrates and derivatives. An important paralog of this gene is RPEL1.
Product OverviewMouse Anti-Marmoset RPE Antibody is a mouse antibody against RPE. It can be used for RPE detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRibulose-phosphate 3-epimerase; EC 5.1.3.1; RPE
UniProt IDF7ECN1
Protein RefseqThe length of the protein is 230 amino acids long.
The sequence is show below: MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSKPEQWVKPMAIAGANQYTFHLEATENPGALIKDIRENGMKSCSFAQAKVQWPSQGPLQVGLAIKPGTSVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAECSGQIPLWLYLCHTFLLDIYLSKT.
See other products for " RPE "
MO-AB-01275LMouse Anti-Elephant RPE Antibody (MO-AB-01275L)
MO-AB-28576HMouse Anti-Rat Rpe Antibody (MO-AB-28576H)
MO-DKB-02038WRabbit Anti-RPE Antibody (MO-DKB-02038W)
MO-AB-09751YMouse Anti-Rabbit RPE Antibody (MO-AB-09751Y)
CBMOAB-89145FYBMouse Anti-Rice RPE Antibody (CBMOAB-89145FYB)
MO-DKB-01912WRabbit Anti-RPE Antibody (MO-DKB-01912W)
CBMOAB-40312FYCMouse Anti-Arabidopsis RPE Antibody (CBMOAB-40312FYC)
CBMOAB-56729FYAMouse Anti-Rhesus RPE Antibody (CBMOAB-56729FYA)
CBMOAB-96362FYAMouse Anti-Zebrafish rpe Antibody (CBMOAB-96362FYA)
MO-AB-07209HMouse Anti-Frog rpe Antibody (MO-AB-07209H)
For Research Use Only | Not For Clinical Use.
Online Inquiry