Mouse Anti-Rat Rpe Antibody (MO-AB-28576H)


Cat: MO-AB-28576H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO28576C
SpecificityThis antibody binds to Rat Rpe.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRPE (Ribulose-5-Phosphate-3-Epimerase) is a protein coding gene. Diseases associated with RPE include 3-Methylglutaconic Aciduria, Type Iii. Among its related pathways are Glycosaminoglycan metabolism and Pentose phosphate pathway. Gene Ontology (GO) annotations related to this gene include protein homodimerization activity and racemase and epimerase activity, acting on carbohydrates and derivatives. An important paralog of this gene is RPEL1.
Product OverviewThis product is a mouse antibody against Rpe. It can be used for Rpe detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein Rpe; Ribulose-5-phosphate-3-epimerase; Rpe; MGC124653
UniProt IDQ3MIF0
Protein RefseqThe length of the protein is 199 amino acids long.
The sequence is show below: MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSRPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTTVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKAGANMIVSGSAIMRSDDPRAVINLLRNVCSEAAQKRSLDR.
For Research Use Only | Not For Clinical Use.
Online Inquiry