Mouse Anti-Marmoset RSPO3 Antibody (MO-AB-63654W)


Cat: MO-AB-63654W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset
CloneMO63654W
SpecificityThis antibody binds to Marmoset RSPO3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene belongs to the R-spondin family. The encoded protein plays a role in the regulation of Wnt (wingless-type MMTV integration site family)/beta-catenin and Wnt/planar cell polarity (PCP) signaling pathways, which are involved in development, cell growth and disease pathogenesis. Genome-wide association studies suggest a correlation of this gene with bone mineral density and risk of fracture. This gene may be involved in tumor development.
Product OverviewMouse Anti-Marmoset RSPO3 Antibody is a mouse antibody against RSPO3. It can be used for RSPO3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesR-spondin-3; RSPO3
UniProt IDU3F8C7
Protein RefseqThe length of the protein is 273 amino acids long.
The sequence is show below: MHLRLISWFFIILNFMEYIGSQNASRGRRQRRTHPNVSQGCQGGCATCSDYNGCLSCKPRLFFVLERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEAKNHTMECVNIVHCEVSEWNPWSPCTKKGKTCGFKRGTEIRVREIIQHPSAKGNLCPPTNETRKCTVQRKKCQKGERGKKGRERKRKKVNKGESKEAIPDSKDLESSKETPEQRENKQQQKKRKVQDKQQKSVSVSTVH.
See other products for " RSPO3 "
CBMOAB-56922FYAMouse Anti-Rhesus RSPO3 Antibody (CBMOAB-56922FYA)
MO-AB-38139WMouse Anti-Goat RSPO3 Antibody (MO-AB-38139W)
CBMOAB-61328FYCMouse Anti-Zebrafish rspo3 Antibody (CBMOAB-61328FYC)
CBMOAB-96720FYAMouse Anti-Zebrafish rspo3 Antibody (CBMOAB-96720FYA)
MO-AB-19633RMouse Anti-Cattle RSPO3 Antibody (MO-AB-19633R)
MO-AB-03873YMouse Anti-Chicken RSPO3 Antibody (MO-AB-03873Y)
MO-AB-18618WMouse Anti-Chimpanzee RSPO3 Antibody (MO-AB-18618W)
MO-AB-28894RMouse Anti-Pig RSPO3 Antibody (MO-AB-28894R)
For Research Use Only | Not For Clinical Use.
Online Inquiry