Mouse Anti-Rhesus RSPO3 Antibody (CBMOAB-56922FYA)


Cat: CBMOAB-56922FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO56922FYA
SpecificityThis antibody binds to Rhesus RSPO3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene belongs to the R-spondin family. The encoded protein plays a role in the regulation of Wnt (wingless-type MMTV integration site family)/beta-catenin and Wnt/planar cell polarity (PCP) signaling pathways, which are involved in development, cell growth and disease pathogenesis. Genome-wide association studies suggest a correlation of this gene with bone mineral density and risk of fracture. This gene may be involved in tumor development.
Product OverviewMouse Anti-Rhesus RSPO3 Antibody is a mouse antibody against RSPO3. It can be used for RSPO3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRSPO3
UniProt IDF6SP05
Protein RefseqThe length of the protein is 293 amino acids long.
The sequence is show below: MHLRLISWFFIMLNFMEYIGSQNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFVLERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVNIVHCEVSEWNPWSPCTKKGKTCGFKRGTETRVREIMQHPSAKGNLCPPTNETRKCTVQRKKCQKGERGKKGRERKRKKPNKGESKEAIPDSKGLESSKETPEQRENKQQQKKRKVQDKQQKSGIEVTLAEGLTSVSQRTQPTPCRRRYL.
For Research Use Only | Not For Clinical Use.
Online Inquiry