Mouse Anti-Marmoset SPP1 Antibody (MO-AB-65242W)


Cat: MO-AB-65242W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset
CloneMO65242W
SpecificityThis antibody binds to Marmoset SPP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is involved in the attachment of osteoclasts to the mineralized bone matrix. The encoded protein is secreted and binds hydroxyapatite with high affinity. The osteoclast vitronectin receptor is found in the cell membrane and may be involved in the binding to this protein. This protein is also a cytokine that upregulates expression of interferon-gamma and interleukin-12. Several transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Marmoset SPP1 Antibody is a mouse antibody against SPP1. It can be used for SPP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOsteopontin isoform OPN-a; SPP1
UniProt IDU3DZR6
Protein RefseqThe length of the protein is 311 amino acids long.
The sequence is show below: MRIAVICFCLLGIAYALPVKRADSGSSEEKQLYNKYPDAVATWLKPDPSQKQNLLAPQNAVSSEETDDFKQETLPSKSNESHDDMDDVDDDDDDDHVDSQDSNDSDEVDHTDDSHQSDESHHSDESDELVTDFPTDLPATEVFTPPVPTIDTYDGRGDSVGYGLRSKSKKFRRSDIQYPDATEEDITSHVESEELNGAYKAIPVAQSLNVPSDWDSHGKDSHEMSQLDDQSAETHSHEQSRLHKRKASDESNEHSDVIDSQEVSKVSREFHSHEFHSQEDLLVVDPKSTEEDKYLKFRISHELDSASSEVN.
See other products for " SPP1 "
MOFY-0722-FY209Rabbit Anti-SPP1 Antibody (MOFY-0722-FY209)
MO-AB-20840RMouse Anti-Cattle SPP1 Antibody (MO-AB-20840R)
CBMOAB-07198FYBMouse Anti-Zebrafish spp1 Antibody (CBMOAB-07198FYB)
MO-AB-10081YMouse Anti-Rabbit SPP1 Antibody (MO-AB-10081Y)
MO-DKB-00335WRabbit Anti-spp1 Antibody (MO-DKB-00335W)
MO-AB-30412RMouse Anti-Pig SPP1 Antibody (MO-AB-30412R)
MOFY-0722-FY430Rabbit Anti-SPP1 Antibody (MOFY-0722-FY430)
MOFY-1222-FY226Rabbit Anti-SPP1 Antibody (MOFY-1222-FY226)
MOFY-0722-FY331Rabbit Anti-SPP1 Antibody (MOFY-0722-FY331)
CBMOAB-58975FYAMouse Anti-Rhesus SPP1 Antibody (CBMOAB-58975FYA)
For Research Use Only | Not For Clinical Use.
Online Inquiry