Mouse Anti-Pig SPP1 Antibody (MO-AB-30412R)


Cat: MO-AB-30412R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa)
CloneMO30412R
SpecificityThis antibody binds to Pig SPP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Golgi apparatus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is involved in the attachment of osteoclasts to the mineralized bone matrix. The encoded protein is secreted and binds hydroxyapatite with high affinity. The osteoclast vitronectin receptor is present in the cell membrane and may be involved in binding to this protein. This protein is also a cytokine that upregulates the expression of interferon-gamma and interleukin-12. Several transcript variants encoding different isoforms have been found for this gene. [Provided by RefSeq, October 2011]
Product OverviewThis product is a mouse antibody against SPP1. It can be used for SPP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSecreted phosphoprotein 1; SPP1
UniProt IDD0G7G0
Protein RefseqThe length of the protein is 303 amino acids long.
The sequence is show below: MRIAVIAFCLWGFASALPVKQTNSGSSEEKLLSNKYTDAVATLLKPDPSQKQTFLAPQNTISSEETDDFKQETLPSKSNESPEQTDDVDDDDDEDHVDSRDTDSEEADHADDADRSDESHHSDESDELVTDFPTDTPATDVTPAVPTGDPNDGRGDSVVYGLRSKSKKFRRSEAQQLDATEEDLTSHVESEETDGTPKAILVAQRLHVASDLDSQEKDSQETSQPDDRSVETRSQEQSKEYTIKTYDGSNEHSNVIESQENPKVSQEFHSHEDKLVPDSKSEEDKHLKLRVSHELESASSEIN.
See other products for " SPP1 "
MOFY-0722-FY15Mouse Anti-SPP1 Antibody (MOFY-0722-FY15)
MO-AB-65242WMouse Anti-Marmoset SPP1 Antibody (MO-AB-65242W)
CBMOAB-58975FYAMouse Anti-Rhesus SPP1 Antibody (CBMOAB-58975FYA)
CBMOAB-04160CRMouse Anti-Yeast SPP1 Antibody (CBMOAB-04160CR)
MO-AB-00611WMouse Anti-Barrel medic SPP1 Antibody (MO-AB-00611W)
CBMOAB-89500FYBMouse Anti-Rice SPP1 Antibody (CBMOAB-89500FYB)
MO-AB-17768YMouse Anti-Sheep SPP1 Antibody (MO-AB-17768Y)
MO-AB-20840RMouse Anti-Cattle SPP1 Antibody (MO-AB-20840R)
MOFY-0722-FY209Rabbit Anti-SPP1 Antibody (MOFY-0722-FY209)
MOFY-0722-FY331Rabbit Anti-SPP1 Antibody (MOFY-0722-FY331)
For Research Use Only | Not For Clinical Use.
Online Inquiry