AibGenesis™ Mouse Anti-marveld1 Antibody (CBMOAB-86066FYA)


Cat: CBMOAB-86066FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-86066FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) WB, ELISA MO86066FYA 100 µg
MO-AB-15380R Monoclonal Cattle (Bos taurus) WB, ELISA MO15380R 100 µg
MO-AB-20091W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20091W 100 µg
MO-AB-26974H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26974C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus)
CloneMO86066FYA
SpecificityThis antibody binds to Zebrafish marveld1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish marveld1 Antibody is a mouse antibody against marveld1. It can be used for marveld1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMARVEL domain-containing protein 1; marveld
UniProt IDQ5BLB7
Protein RefseqThe length of the protein is 162 amino acids long.
The sequence is show below: MPTQPQEKRSFLQFLKSFVGIVRVLQILLGAGLWVTIAANKYEGSIHFVLFVAVLFWLLTLAIFILTLLDKQDLVPIVGGERWLLSNLIHDVVATLLYLSTIGIMIYKTQKNSYCNLDVYKHHCLYKVYLTASVFACLTAAVYLLSGIYCSCRKCRGERTVV.
For Research Use Only | Not For Clinical Use.
Online Inquiry