AibGenesis™ Mouse Anti-mb21d2 Antibody (CBMOAB-86148FYA)


Cat: CBMOAB-86148FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-86148FYA Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO86148FYA 100 µg
MO-AB-19274W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19274W 100 µg
MO-AB-58799W Monoclonal Marmoset WB, ELISA MO58799W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset
CloneMO86148FYA
SpecificityThis antibody binds to Zebrafish mb21d2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish mb21d2 Antibody is a mouse antibody against mb21d2. It can be used for mb21d2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesmb21d2; mb21d2a si:ch211-170h3.5; Mab-21 Domain Containing 2
UniProt IDB8JLG8
Protein RefseqThe length of the protein is 510 amino acids long.
The sequence is show below: MAAPAPSSRTGSVSSSLGNSPTATPGPGGLNNGHKLWCCHELDFRSGVKIEELNRLIHEFSKQDQREYDDQRALEIHTAKDFIFSMLGMVQKLDQKLPVANEYLLLSGGVREGVVDMDVDELGVYTRGSDYDMAFTLLVPALKLHDRNQPVTLDMRHSALGHSWLSLRLFDEGTINRWRDCCTLTDHLNGTTNYFFSPTMVADWFQEAVGLVLAELQRKPQRGTPRVERVERHSTLLSMVLGVGSSRMLYDIVPVVSFKGWPAVAQSWLMENHFWDGKITEEEVISGFYLLPACSASGCRENEWRLSFARSEVQLKKCISPGLMQAYQACKAIVVKLLGQPTAISPYYLRSMMLWACDRLPATYLSQDDYAAYFLLGLIDDLQHCLVNKACPNYFIPQCNMLEHLCDETAMFHARKLALVRSDPAEHLRSIIEQAKASNRLTQEMQRCGSSSGLPSPLADSSLADHQQPDDRLAKKLQQLVTENPGKSISVFINPDDVTRPHFRIDDKFF.
For Research Use Only | Not For Clinical Use.
Online Inquiry