AibGenesis™ Mouse Anti-mblac2 Antibody (CBMOAB-86169FYA)


Cat: CBMOAB-86169FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-86169FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO86169FYA 100 µg
MO-AB-15410R Monoclonal Cattle (Bos taurus) WB, ELISA MO15410R 100 µg
MO-AB-23197W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23197W 100 µg
MO-AB-58813W Monoclonal Marmoset WB, ELISA MO58813W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO86169FYA
SpecificityThis antibody binds to Zebrafish mblac2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish mblac2 Antibody is a mouse antibody against mblac2. It can be used for mblac2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesmblac2; Metallo-Beta-Lactamase Domain Containing 2
UniProt IDB0R0T6
Protein RefseqThe length of the protein is 275 amino acids long.
The sequence is show below: MAATDWYAHKSLENGVFWIQERFYESGNRANIWLIRGSHQDVVIDTGLGLRSLPEYIQEKSLLGDDAKRKNPLLAIGTHVHFDHSGGLHQFQQVGVHKAEVDALANGDNFETVTWLSDREIVEVPSPGWRARQYRVKAVTPTHILQEGDVINLGDRQLSVLHMPGHSRGSICLHDKESKMLFSGDVVYDGSMIDWLPYSRISDYIHSCERLVEMVDKEEIDQVMPGHYNTFGGKRLHRLASNYIASAGTCHRASTSVVKSIASLALRASNSRSAC.
For Research Use Only | Not For Clinical Use.
Online Inquiry