AibGenesis™ Mouse Anti-MCM8 Antibody (MO-AB-15465R)


Cat: MO-AB-15465R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-15465R Monoclonal Cattle (Bos taurus), A. thaliana (Arabidopsis thaliana), Chimpanzee (Pan troglodytes), Rhesus (Macaca mulatta), Rice (Oryza), Zebrafish (Danio rerio) WB, ELISA MO15465R 100 µg
CBMOAB-36311FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO36311FC 100 µg
CBMOAB-86324FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO86324FYA 100 µg
CBMOAB-34624FYB Monoclonal Rice (Oryza) WB, ELISA MO34624FYB 100 µg
MO-AB-04348W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04348W 100 µg
MO-AB-20799W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20799W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), A. thaliana (Arabidopsis thaliana), Chimpanzee (Pan troglodytes), Rhesus (Macaca mulatta), Rice (Oryza), Zebrafish (Danio rerio)
CloneMO15465R
SpecificityThis antibody binds to Cattle MCM8.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the mini-chromosome maintenance proteins is a key component of the pre-replication complex and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein contains the central domain that is conserved among the mini-chromosome maintenance proteins. The encoded protein may interact with other mini-chromosome maintenance proteins and play a role in DNA replication. This gene may be associated with length of reproductive lifespan and menopause. Alternatively spliced transcript variants encoding distinct isoforms have been described. (From NCBI)
Product OverviewMouse Anti-Cattle MCM8 Antibody is a mouse antibody against MCM8. It can be used for MCM8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDNA helicase MCM8; EC 3.6.4.12; Minichromosome maintenance 8; MCM8
UniProt IDE1BPX4
Protein RefseqThe length of the protein is 816 amino acids long.
The sequence is show below: MNGKYRGRGFGQGRFQSWKSGRGGRGFSGKWREREHRPDLNKATGKHPEQTPQSLLLQSTLDHFIPYKGWKLYFSEVYSDSIPFIEKIEAFESFFTERIELYDKDEIERKGSILVDFKELINDDEIIKLIPNIANELRDTPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSRNGETVVNVPHIHARVYNYEPLTQLKNVRANYYGKYIALRGTVVRVSNTKPLCTKMAFLCAACGEIQSLSLPDGKYNLPTK.
For Research Use Only | Not For Clinical Use.
Online Inquiry