AibGenesis™ Mouse Anti-med29 Antibody (CBMOAB-86458FYA)


Cat: CBMOAB-86458FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-86458FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus), Sheep (Ovis aries) WB, ELISA MO86458FYA 100 µg
MO-AB-15528R Monoclonal Cattle (Bos taurus) WB, ELISA MO15528R 100 µg
MO-AB-16133Y Monoclonal Sheep (Ovis aries) WB, ELISA MO16133Y 100 µg
MO-AB-19918W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19918W 100 µg
MO-AB-27039H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27039C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus), Sheep (Ovis aries)
CloneMO86458FYA
SpecificityThis antibody binds to Zebrafish med29.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish med29 Antibody is a mouse antibody against med29. It can be used for med29 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMediator of RNA polymerase II transcription subunit 29; Intersex-like protein; Mediator complex subunit 29; med29; ix
UniProt IDQ8JHI6
Protein RefseqThe length of the protein is 179 amino acids long.
The sequence is show below: MASQQMSTNNAQMSAQQAAVLQQTQAQQLSQQQDFDPVHRFKMLIPPLKDSLQNVMTIASLNFAHNTAIDNGLKTTEKGNDAAVQRFDKSLEEFYALCDQLELCLRLAHECLSQSIDSTKHSPNLVPTATKPDTVQTESLSYSQYLSMIKSQISCAKDIHNALLECSKKIAGKGQGACN.
For Research Use Only | Not For Clinical Use.
Online Inquiry