AibGenesis™ Mouse Anti-Med30 Antibody (CBMOAB-23588FYA)


Cat: CBMOAB-23588FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-23588FYA Monoclonal Fruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO23588FYA 100 µg
CBMOAB-36359FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO36359FC 100 µg
CBMOAB-86460FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO86460FYA 100 µg
MO-AB-15529R Monoclonal Cattle (Bos taurus) WB, ELISA MO15529R 100 µg
MO-AB-24894W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24894W 100 µg
MO-AB-27040H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27040C 100 µg
MO-AB-58940W Monoclonal Marmoset WB, ELISA MO58940W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO23588FYA
SpecificityThis antibody binds to fruit fly Med30.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionComponent of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Med30 Antibody is a mouse antibody against Med30. It can be used for Med30 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMediator of RNA polymerase II transcription subunit 30; Mediator complex subunit 30; dMED20; dTRAP25; MED30; Trap25
UniProt IDQ9W0P3
Protein RefseqThe length of the protein is 318 amino acids long.
The sequence is show below: MWKYGQNQGNQGPSSGGGGGGGPNMMPMGGFGMQHGNMQQMHMSPQHQQQQQQMGMMGGPGSMQMNPQGPGGPGGLMPGMSPQHQMQQQQQQQMMQQQMMVPQQGVGVGVGMGGGVGMGGGGVVPQQQQQQPQQNMPQQNIPQQQQQLNPVAGIPPGGAGGSNNMLAISQQNPHKEINIVQLSRLGQETVQDIASRFQEVFASLKGIQPTSHRENSSEKKVQEYFRTIRLLFKRVRIIYEKCNDAGMDYMSAESLIPYRDEPEPRIEPSLCDEYRKVLQENHELIETVKLKNRQLREIIDRTRIIIWEINTMLAMRRS.
For Research Use Only | Not For Clinical Use.
Online Inquiry