Mouse Anti-Medaka wnt6 Antibody (MO-AB-01932R)


Cat: MO-AB-01932R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMedaka (Oryzias latipes)
CloneMO01932R
SpecificityThis antibody binds to Medaka wnt6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It is overexpressed in cervical cancer cell line and strongly coexpressed with another family member, WNT10A, in colorectal cancer cell line. The gene overexpression may play key roles in carcinogenesis. This gene and the WNT10A gene are clustered in the chromosome 2q35 region. The protein encoded by this gene is 97% identical to the mouse Wnt6 protein at the amino acid level.
Product OverviewThis product is a mouse antibody against wnt6. It can be used for wnt6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein Wnt, Fragment; LOC101174712
UniProt IDH2MVL0
Protein RefseqThe length of the protein is 338 amino acids long.
The sequence is show below: QTFIFGHGCRAVGSPLVMDPNSICRKAKRLVGKQAELCQTQPEIVNEVARGARLGVRECQYQFRYRRWNCTSHNKYFGKILQQDIRETAFVYAITAAGVTHAVTQACSMGELLQCGCEATRNRAPPRPPSSSSPRDGVKWEWGGCGDDVEFGYEKSKQFMDARRRRGKSDIRTLIDLHNNEAGRLAVKLYMRTECKCHGLSGSCTLRTCWKKMPHFREVGDRLLERFNGAAKVMGSNDGKTLIPVGHNIKPPDKQDLIYSDESPDFCSANRKTGSLGTRGRTCNSTAMDISGCDLLCCERGYWEETVVSEENCLCRFHWCCVVQCKKCLVRKELNLCH.
For Research Use Only | Not For Clinical Use.
Online Inquiry