AibGenesis™ Mouse Anti-METTL6 Antibody (CBMOAB-51201FYA)


Cat: CBMOAB-51201FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51201FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Pig (Sus scrofa), Bovine (Bos taurus), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO51201FYA 100 µg
CBMOAB-86632FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO86632FYA 100 µg
MO-AB-13681W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13681W 100 µg
MO-AB-59012W Monoclonal Marmoset WB, ELISA MO59012W 100 µg
MO-DKB-01290W Polyclonal Human (Homo sapiens), Pig (Sus scrofa), Bovine (Bos taurus), Rhesus (Macaca mulatta) WB, IF 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Pig (Sus scrofa), Bovine (Bos taurus), Marmoset, Zebrafish (Danio rerio)
CloneMO51201FYA
SpecificityThis antibody binds to Rhesus METTL6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus METTL6 Antibody is a mouse antibody against METTL6. It can be used for METTL6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMETTL6
UniProt IDF7CDC5
Protein RefseqThe length of the protein is 255 amino acids long.
The sequence is show below: MTSLPRKRLQARVLSSEEEEKLKRDQTLVSDFKQHKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEELRSCREFEDQKLTILEAGCGVGNCLFPLLEEDPNIFAYACDFSPRAVEYVKQNPLYDTERCKVFQCDLTKDDLLDHVPPGSVDVVMLIFVLSAVHPEKMHLVLENIYKVLKPGKSVLFRDYGLYDHAMLRFKAGSKLGENFYVRQDGTRSYFFTDEFLAQLFMDTGYEEVVNEYVFRETVNKKEGL.
For Research Use Only | Not For Clinical Use.
Online Inquiry