AibGenesis™ Mouse Anti-METTL7B Antibody (CBMOAB-51203FYA)


Cat: CBMOAB-51203FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51203FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Pig (Sus scrofa), Rat (Rattus norvegicus) WB, ELISA MO51203FYA 100 µg
MO-AB-14924W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14924W 100 µg
MO-AB-27062H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27062C 100 µg
MO-AB-27273R Monoclonal Pig (Sus scrofa) WB, ELISA MO27273R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Pig (Sus scrofa), Rat (Rattus norvegicus)
CloneMO51203FYA
SpecificityThis antibody binds to Rhesus METTL7B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus METTL7B Antibody is a mouse antibody against METTL7B. It can be used for METTL7B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMethyltransferase-like protein 7B; METTL7B
UniProt IDI2CT61
Protein RefseqThe length of the protein is 244 amino acids long.
The sequence is show below: MDVLVPLLQLLVLLLTLPLHLMALLGCWQPLCKTYFPYLMAVLTSKSNRKMEGKKRELFSQIKGLTGASGKVDLLELGCGTGANFQFYPPGCRVTCLDPNPHFEKFLTKSMAENRHLQYERFVVAPGEDMRQLADGSMDVVVCTLVLCSVQSPRKVLQEVQRVLRPGGVLFFWEHVTEPHGSWAFMWQQVLEPTWKHIGDGCCLTRETWKDLENAQFSEIQMERQPPPFKWLPVGPHIMGKAVK.
For Research Use Only | Not For Clinical Use.
Online Inquiry