AibGenesis™ Mouse Anti-MFSD7 Antibody (CBMOAB-51244FYA)


Cat: CBMOAB-51244FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51244FYA Monoclonal Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO51244FYA 100 µg
CBMOAB-86696FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO86696FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO51244FYA
SpecificityThis antibody binds to Rhesus MFSD7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus MFSD7 Antibody is a mouse antibody against MFSD7. It can be used for MFSD7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMFSD7
UniProt IDF7FK15
Protein RefseqThe length of the protein is 193 amino acids long.
The sequence is show below: LHPRAVPAHAGRSLSPGRPWDRWRPMEPRTMAGQTGADPGLAEPRALCAQQAHRTYARRWVFLLVVSLVSCSNAMLWLSFAPVADIVAEHFVLSVAQVNWLSLVYLVVSTLFGLVAIWVLDSVGLRGATILGAWLNFAGSVLRVVPCVVVGTQNPFAFLMGGQSLCALAQSLVIFSPAKVAALWFPEHQRATA.
For Research Use Only | Not For Clinical Use.
Online Inquiry