AibGenesis™ Mouse Anti-MIC1 Antibody (CBMOAB-51394FYA)


Cat: CBMOAB-51394FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51394FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO51394FYA 100 µg
MO-AB-15784R Monoclonal Cattle (Bos taurus) WB, ELISA MO15784R 100 µg
MO-AB-26860W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26860W 100 µg
MO-AB-59073W Monoclonal Marmoset WB, ELISA MO59073W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO51394FYA
SpecificityThis antibody binds to Rhesus MIC1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus MIC1 Antibody is a mouse antibody against MIC1. It can be used for MIC1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMHC class I related protein; MIC1
UniProt IDO98268
Protein RefseqThe length of the protein is 359 amino acids long.
The sequence is show below: FLASIFPFARPGAAAELHSLRYNVTVLSRDGSVQSGFLAEGHLDGQLFLLYDRQKCRARPQGEWSEDVLGAKTWDTETGDLTENGKDLRMTLAHIKGQKGGLHSLQEIKVCEIHEDNSTGGLRHFYYDGELFLSQNLETQEWTELQSSRAQTLALNIRNFWKEDTMKTKTHYRTVQADCLKKLQQYLESRVAVRRTAPPMVNVTHSEASEGNITVTCRASGFYPRNIALTWRQDGVSLNHNAQQWGGILPDQNGTYQTWVATRIRQGEEQRFACYMEHSGNHSTHPVPSGKVLVFQSQWLDIPYVLAVAAAVAAAAIFVIILYVLCCKKKTSAAEGPELVSLRTLDQHPVGTGDHRDAT.
For Research Use Only | Not For Clinical Use.
Online Inquiry