AibGenesis™ Mouse Anti-MIK Antibody (MO-AB-36284W)


Cat: MO-AB-36284W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-36284W Monoclonal French-bean, Maize (Zea mays) WB, ELISA MO36284W 100 µg
MO-AB-48720W Monoclonal Maize (Zea mays) WB, ELISA MO48720W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrench-bean, Maize (Zea mays)
CloneMO36284W
SpecificityThis antibody binds to French-bean MIK.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-French-bean MIK Antibody is a mouse antibody against MIK. It can be used for MIK detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMyo-inositol kinase; MIK
UniProt IDC1LZ48
Protein RefseqThe length of the protein is 238 amino acids long.
The sequence is show below: WPTACTAETLGGAASFISVILDALSLPFHTVSKVGPEFAYAAATSLHPPLTIPTSRTTLFHAHFSSGNPDRLLNRVVSCDTIRPEDLPVQTRFAFGLAVGVGGEILPETLERMLEICDIVFVDVQGLIRRFSPSDGRVSHVALSESGFLHLLPRVAFLKASADEAPFIDVEEARRWCCVVVTHGKDGCEVFCENGAFRAAPFKADQVDPTGAGDCFLGGFAAGIVRGLSVPDAALLGK.
For Research Use Only | Not For Clinical Use.
Online Inquiry