AibGenesis™ Mouse Anti-MINPP1 Antibody (CBMOAB-51442FYA)


Cat: CBMOAB-51442FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51442FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO51442FYA 100 µg
MO-AB-02912Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO02912Y 100 µg
MO-AB-04423W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04423W 100 µg
MO-AB-15810R Monoclonal Cattle (Bos taurus) WB, ELISA MO15810R 100 µg
MO-AB-22864W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22864W 100 µg
MO-AB-59123W Monoclonal Marmoset WB, ELISA MO59123W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO51442FYA
SpecificityThis antibody binds to Rhesus MINPP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes multiple inositol polyphosphate phosphatase; an enzyme that removes 3-phosphate from inositol phosphate substrates. It is the only enzyme known to hydrolzye inositol pentakisphosphate and inositol hexakisphosphate. This enzyme also converts 2,3 bisphosphoglycerate (2,3-BPG) to 2-phosphoglycerate; an activity formerly thought to be exclusive to 2,3-BPG synthase/2-phosphatase (BPGM) in the Rapoport-Luebering shunt of the glycolytic pathway. (From NCBI)
Product OverviewMouse Anti-Rhesus MINPP1 Antibody is a mouse antibody against MINPP1. It can be used for MINPP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMINPP1
UniProt IDF6SM78
Protein RefseqThe length of the protein is 487 amino acids long.
The sequence is show below: MIRAPRCFLRTSVAPAAALAAALLSSLARCSFLEPRDPVDSSLSPYFGTKTRYEDVNPGLLSGPEAPWRDPELLEGTCTPVQLVALIRHGTRYPTAKQIRKLRQLHGLLQARGSRDGGGSSTGSRDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLITSSKHRCVDSGAAFLQGLWQHYHPGLPPPDVADMECGPPRVNDKLMRFFDHCEKFLTEVEKNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNADLIQVAFFTCSFDLAIKGVKSPWCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKAVEQKQRSQPISSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKEQMHRKFRSGHIVPYASNLIFVLYHCENAKTPKEQFRVQMLLNEKVLPLAYSPETVSFYEDLKNHYKDILQSCQTSEECELAKANSTSDEL.
For Research Use Only | Not For Clinical Use.
Online Inquiry