AibGenesis™ Mouse Anti-MMAA Antibody (CBMOAB-51521FYA)
Cat: CBMOAB-51521FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-51521FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio) | WB, ELISA | MO51521FYA | 100 µg | ||
| CBMOAB-87075FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO87075FYA | 100 µg | ||
| MO-AB-04446W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO04446W | 100 µg | ||
| MO-AB-08831Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO08831Y | 100 µg | ||
| MO-AB-15846R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO15846R | 100 µg | ||
| MO-AB-21675W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO21675W | 100 µg | ||
| MO-AB-59177W | Monoclonal | Marmoset | WB, ELISA | MO59177W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio) |
| Clone | MO51521FYA |
| Specificity | This antibody binds to Rhesus MMAA. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene is involved in the translocation of cobalamin into the mitochondrion, where it is used in the final steps of adenosylcobalamin synthesis. Adenosylcobalamin is a coenzyme required for the activity of methylmalonyl-CoA mutase. Defects in this gene are a cause of methylmalonic aciduria. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus MMAA Antibody is a mouse antibody against MMAA. It can be used for MMAA detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Methylmalonic aciduria type A protein, mitochondrial; MMAA |
| UniProt ID | H9EZF1 |
| Protein Refseq | The length of the protein is 63 amino acids long. The sequence is show below: MPMLLPHPHQHFLKGLLRASFRCYHFIFHSSTHLGSGIPCAQPFNSLGLHCTKWMLLSNGLKR. |
For Research Use Only | Not For Clinical Use.
Online Inquiry