AibGenesis™ Mouse Anti-MMP19 Antibody (CBMOAB-51533FYA)


Cat: CBMOAB-51533FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51533FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes) WB, ELISA MO51533FYA 100 µg
MO-AB-15868R Monoclonal Cattle (Bos taurus) WB, ELISA MO15868R 100 µg
MO-AB-20733W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20733W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes)
CloneMO51533FYA
SpecificityThis antibody binds to Rhesus MMP19.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of a family of proteins that are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded protein is secreted as an inactive proprotein, which is activated upon cleavage by extracellular proteases. Alternative splicing results in multiple transcript variants for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus MMP19 Antibody is a mouse antibody against MMP19. It can be used for MMP19 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMMP19
UniProt IDF7HL17
Protein RefseqThe length of the protein is 81 amino acids long.
The sequence is show below: MNWQQLWLGFLLPMTVSGRVLGLAEEMAVEYLSQYGYLQKPLEGSNNFKPEDITEALRESPGPCRHPRAGQCALRRRRVLD.
For Research Use Only | Not For Clinical Use.
Online Inquiry