Mouse Anti-mmp9 Antibody (CBMOAB-87134FYA)


Cat: CBMOAB-87134FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-87134FYA Monoclonal Zebrafish (Danio rerio), Bovine, Cattle (Bos taurus), Dog, Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rabbit, Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) WB, ELISA MO87134FYA 100 µg
MO-AB-05241H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05241C 100 µg
MO-AB-08851Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08851Y 100 µg
MO-AB-12095Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO12095Y 100 µg
MO-AB-15881R Monoclonal Cattle (Bos taurus) WB, ELISA MO15881R 100 µg
MO-AB-16176Y Monoclonal Sheep (Ovis aries) WB, ELISA MO16176Y 100 µg
MO-AB-27343R Monoclonal Pig (Sus scrofa) WB, ELISA MO27343R 100 µg
MO-AB-31810W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO31810W 100 µg
MO-AB-59193W Monoclonal Marmoset WB, ELISA MO59193W 100 µg
MOFY-0722-FY39 Monoclonal Bovine WB, IHC, ICC, IP 100 µg
MO-NAB-00462W Monoclonal Zebrafish (Danio rerio) WB, ELISA, IHC NW0386 100 µg
MOFY-0622-FY195 Polyclonal Rabbit WB, IHC, ICC, IP 100 µg
MOFY-0722-FY150 Polyclonal Dog WB, IHC, ICC, IP 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Bovine, Cattle (Bos taurus), Dog, Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rabbit, Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries)
CloneMO87134FYA
SpecificityThis antibody binds to Zebrafish mmp9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionProteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades type IV and V collagens. Studies in rhesus monkeys suggest that the enzyme is involved in IL-8-induced mobilization of hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling. (From NCBI)
Product OverviewMouse Anti-Zebrafish mmp9 Antibody is a mouse antibody against mmp9. It can be used for mmp9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMatrix metalloproteinase 9; mmp
UniProt IDQ7T317
Protein RefseqThe length of the protein is 680 amino acids long.
The sequence is show below: MRLGVLAFLVLGTCSLRAWCLPLKSVFVTFPGDVIKNMTNTQLADEYLKRYGYVDVLQRSGLQAVISNAKALKKLQRQLGLEETGLLDQPTVDAMKQPRCGVPDIRNYKTFDGDLKWDHTDVTYRILNYSPDMEASLIDDAFARAFKVWSDVTPLTFTRLFDGIADIMISFGKLDHGDPYPFDGKDGLLAHAYPPGEGTQGDAHFDDDEYWTLGSGPAIQTRYGNAEGAMCHFPFLFEGTSYSTCTTEGRTDGLPWCSTTADYDKDKKFGFCPSELLFTFDGNSNEAPCVFPFVFDGKKYDSCTTEGRNDGYRWCSTTANFDTDKKYGFCPNRDTAVIGGNSEGEPCHFPFTFLGNTYSSCTSEGRNDGKLWCGTTSNYDTDKKWGFCPDRGYSLFLVAAHEFGHALGLDHSNIKDALMYPMYKYVEGFPLHRDDIDGIQYLYGPRTGPEPTAPQPRTTTSSPVVPTKPSPSDKTTTASTTTQVVPSDDACQIKEFDAITEIQKELHFFKDGRYWKISGNGERKGPFMISAKWPALPAVINSAFEDHLTKKIYFFSERQFWVYSGNDVLGPRKIEKLGLPSDLDKVEGSMQRGKGKVLLFNGENFWRLDVKAQLIDRGYPRFTDAAFGGVPIDSHDVFLYKGFFYFCRESFYWRMNAKRQVDRVGYVKYDLLKCSDIHSL.
For Research Use Only | Not For Clinical Use.
Online Inquiry