Mouse Anti-mmp9 Antibody (CBMOAB-87134FYA)
Cat: CBMOAB-87134FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-87134FYA | Monoclonal | Zebrafish (Danio rerio), Bovine, Cattle (Bos taurus), Dog, Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rabbit, Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) | WB, ELISA | MO87134FYA | 100 µg | ||
MO-AB-05241H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO05241C | 100 µg | ||
MO-AB-08851Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO08851Y | 100 µg | ||
MO-AB-12095Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO12095Y | 100 µg | ||
MO-AB-15881R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO15881R | 100 µg | ||
MO-AB-16176Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO16176Y | 100 µg | ||
MO-AB-27343R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO27343R | 100 µg | ||
MO-AB-31810W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO31810W | 100 µg | ||
MO-AB-59193W | Monoclonal | Marmoset | WB, ELISA | MO59193W | 100 µg | ||
MOFY-0722-FY39 | Monoclonal | Bovine | WB, IHC, ICC, IP | 100 µg | |||
MO-NAB-00462W | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA, IHC | NW0386 | 100 µg | ||
MOFY-0622-FY195 | Polyclonal | Rabbit | WB, IHC, ICC, IP | 100 µg | |||
MOFY-0722-FY150 | Polyclonal | Dog | WB, IHC, ICC, IP | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Zebrafish (Danio rerio), Bovine, Cattle (Bos taurus), Dog, Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rabbit, Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) |
Clone | MO87134FYA |
Specificity | This antibody binds to Zebrafish mmp9. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Extracellular region or secreted |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades type IV and V collagens. Studies in rhesus monkeys suggest that the enzyme is involved in IL-8-induced mobilization of hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling. |
Product Overview | Mouse Anti-Zebrafish mmp9 Antibody is a mouse antibody against mmp9. It can be used for mmp9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Matrix metalloproteinase 9; mmp |
UniProt ID | Q7T317 |
Protein Refseq | The length of the protein is 680 amino acids long. The sequence is show below: MRLGVLAFLVLGTCSLRAWCLPLKSVFVTFPGDVIKNMTNTQLADEYLKRYGYVDVLQRSGLQAVISNAKALKKLQRQLGLEETGLLDQPTVDAMKQPRCGVPDIRNYKTFDGDLKWDHTDVTYRILNYSPDMEASLIDDAFARAFKVWSDVTPLTFTRLFDGIADIMISFGKLDHGDPYPFDGKDGLLAHAYPPGEGTQGDAHFDDDEYWTLGSGPAIQTRYGNAEGAMCHFPFLFEGTSYSTCTTEGRTDGLPWCSTTADYDKDKKFGFCPSELLFTFDGNSNEAPCVFPFVFDGKKYDSCTTEGRNDGYRWCSTTANFDTDKKYGFCPNRDTAVIGGNSEGEPCHFPFTFLGNTYSSCTSEGRNDGKLWCGTTSNYDTDKKWGFCPDRGYSLFLVAAHEFGHALGLDHSNIKDALMYPMYKYVEGFPLHRDDIDGIQYLYGPRTGPEPTAPQPRTTTSSPVVPTKPSPSDKTTTASTTTQVVPSDDACQIKEFDAITEIQKELHFFKDGRYWKISGNGERKGPFMISAKWPALPAVINSAFEDHLTKKIYFFSERQFWVYSGNDVLGPRKIEKLGLPSDLDKVEGSMQRGKGKVLLFNGENFWRLDVKAQLIDRGYPRFTDAAFGGVPIDSHDVFLYKGFFYFCRESFYWRMNAKRQVDRVGYVKYDLLKCSDIHSL. |
For Research Use Only | Not For Clinical Use.
Online Inquiry