AibGenesis™ Mouse Anti-MMRN2 Antibody (CBMOAB-51542FYA)


Cat: CBMOAB-51542FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51542FYA Monoclonal Rhesus (Macaca mulatta), Marmoset WB, ELISA MO51542FYA 100 µg
MO-AB-04448W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04448W 100 µg
MO-AB-59195W Monoclonal Marmoset WB, ELISA MO59195W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset
CloneMO51542FYA
SpecificityThis antibody binds to Rhesus MMRN2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein belonging to the member of elastin microfibril interface-located (EMILIN) protein family. This family member is an extracellular matrix glycoprotein that can interfere with tumor angiogenesis and growth. It serves as a transforming growth factor beta antagonist and can interfere with the VEGF-A/VEGFR2 pathway. A related pseudogene has been identified on chromosome 6. (From NCBI)
Product OverviewMouse Anti-Rhesus MMRN2 Antibody is a mouse antibody against MMRN2. It can be used for MMRN2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMultimerin-2; MMRN2
UniProt IDH9FEB4
Protein RefseqThe length of the protein is 66 amino acids long.
The sequence is show below: PDCQRVKVMYRMAHKPVYQVKQKVLTSLAWRCCPGYTGPNCEHHDSMAIPEPADPSDSHQEPGDGP.
For Research Use Only | Not For Clinical Use.
Online Inquiry