AibGenesis™ Mouse Anti-MMRN2 Antibody (CBMOAB-51542FYA)
Cat: CBMOAB-51542FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-51542FYA | Monoclonal | Rhesus (Macaca mulatta), Marmoset | WB, ELISA | MO51542FYA | 100 µg | ||
| MO-AB-04448W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO04448W | 100 µg | ||
| MO-AB-59195W | Monoclonal | Marmoset | WB, ELISA | MO59195W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Marmoset |
| Clone | MO51542FYA |
| Specificity | This antibody binds to Rhesus MMRN2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a protein belonging to the member of elastin microfibril interface-located (EMILIN) protein family. This family member is an extracellular matrix glycoprotein that can interfere with tumor angiogenesis and growth. It serves as a transforming growth factor beta antagonist and can interfere with the VEGF-A/VEGFR2 pathway. A related pseudogene has been identified on chromosome 6. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus MMRN2 Antibody is a mouse antibody against MMRN2. It can be used for MMRN2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Multimerin-2; MMRN2 |
| UniProt ID | H9FEB4 |
| Protein Refseq | The length of the protein is 66 amino acids long. The sequence is show below: PDCQRVKVMYRMAHKPVYQVKQKVLTSLAWRCCPGYTGPNCEHHDSMAIPEPADPSDSHQEPGDGP. |
For Research Use Only | Not For Clinical Use.
Online Inquiry