AibGenesis™ Mouse Anti-MOB3B Antibody (CBMOAB-51558FYA)


Cat: CBMOAB-51558FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51558FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO51558FYA 100 µg
MO-AB-15896R Monoclonal Cattle (Bos taurus) WB, ELISA MO15896R 100 µg
MO-AB-27137H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27137C 100 µg
MO-AB-59209W Monoclonal Marmoset WB, ELISA MO59209W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus)
CloneMO51558FYA
SpecificityThis antibody binds to Rhesus MOB3B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene shares similarity with the yeast Mob1 protein. Yeast Mob1 binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. This gene is located on the opposite strand as the interferon kappa precursor (IFNK) gene. (From NCBI)
Product OverviewMouse Anti-Rhesus MOB3B Antibody is a mouse antibody against MOB3B. It can be used for MOB3B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMOB3B
UniProt IDF7GD10
Protein RefseqThe length of the protein is 207 amino acids long.
The sequence is show below: MSIALKQVFNKDKTFRPKRKFEPGTQRFELHKRAQASLNSGVDLKAAVQLPSGEDQNDWVAVHVVDFFNRINLIYGTICEFCTERTCPVMSGGPKYEYRWQDDLKYKKPTALPAPQYMNLLMDWIEVQINNEEIFPTCVGVPFPKNFLQICKKILCRLFRVFVHVYIHHFDRVIVMGAEAHVNTCYKHFYYFVTEMNLIDRKELEPL.
For Research Use Only | Not For Clinical Use.
Online Inquiry