AibGenesis™ Mouse Anti-morn5 Antibody (CBMOAB-87217FYA)


Cat: CBMOAB-87217FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-87217FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus) WB, ELISA MO87217FYA 100 µg
MO-AB-15926R Monoclonal Cattle (Bos taurus) WB, ELISA MO15926R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus)
CloneMO87217FYA
SpecificityThis antibody binds to Zebrafish morn5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMORN5 (MORN Repeat Containing 5) is a Protein Coding gene.
Product OverviewMouse Anti-Zebrafish morn5 Antibody is a mouse antibody against morn5. It can be used for morn5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMORN repeat-containing protein 5; morn
UniProt IDQ4VBJ9
Protein RefseqThe length of the protein is 178 amino acids long.
The sequence is show below: MELMGSSYDGDYNNGRMEGTGEYTIPTHTRYVGEMKDGMFHGKGVLHFPNGSKYEGTWEKGICKEGKYTFSDGLKYKETDWDYCDGKDRRFYSERCNGLKPAGESQLTDPDPPRVIPDGCYDTGDGFYDPNTRVVKGYDGNFLRNADDQEHEWIVLSCRKSLDEFTGYCPRASTLEEK.
For Research Use Only | Not For Clinical Use.
Online Inquiry