AibGenesis™ Mouse Anti-MPK4 Antibody (CBMOAB-34694FYB)


Cat: CBMOAB-34694FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-34694FYB Monoclonal Rice (Oryza), A. thaliana (Arabidopsis thaliana), Rice WB, ELISA MO34694FYB 100 µg
CBMOAB-36673FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO36673FC 100 µg
MO-DKB-02151W Polyclonal A. thaliana (Arabidopsis thaliana) WB 100 µg
MO-MMB-0202 Polyclonal Rice ELISA, WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), A. thaliana (Arabidopsis thaliana), Rice
CloneMO34694FYB
SpecificityThis antibody binds to Rice MPK4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rice MPK4 Antibody is a mouse antibody against MPK4. It can be used for MPK4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMitogen-activated protein kinase 4; MAP kinase 4; EC 2.7.11.24; Multiple stress-responsive MAP kinase 3; OsMAP2; OsMSRMK3; MPK4; MAP2 MSRMK3; Os06g0699400 LOC_Os06g48590
UniProt IDQ5Z859
Protein RefseqThe length of the protein is 369 amino acids long.
The sequence is show below: MAMMVDPPNGMGNQGKHYYTMWQTLFEIDTKYVPIKPIGRGAYGIVCSSINRATNEKVAIKKINNVFDNRVDALRTLRELKLLRHLRHENVIALKDIMMPVHRRSFKDVYLVYELMDTDLHQIIKSSQPLSNDHCQYFLFQLLRGLKYLHSAGILHRDLKPGNLLVNANCDLKICDFGLARTNNTKGQFMTEYVVTRWYRAPELLLCCDNYGTSIDVWSVGCIFAELLGRKPIFPGTECLNQLKLIVNVLGTMSEADIEFIDNPKARKYIKTLPYTPGIPLTSMYPQAHPLAIDLLQKMLVFDPSKRISVTEALEHPYMSPLYDPSANPPAQVPIDLDIDENLGVDMIREMMWQEMLHYHPEVVAGVNM.
For Research Use Only | Not For Clinical Use.
Online Inquiry