AibGenesis™ Mouse Anti-MPK5 Antibody (CBMOAB-34695FYB)


Cat: CBMOAB-34695FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-34695FYB Monoclonal Rice (Oryza), A. thaliana (Arabidopsis thaliana), Rice WB, ELISA MO34695FYB 100 µg
CBMOAB-36676FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO36676FC 100 µg
MO-MMB-0069 Polyclonal Rice ELISA, WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), A. thaliana (Arabidopsis thaliana), Rice
CloneMO34695FYB
SpecificityThis antibody binds to Rice MPK5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionInvolved in disease resistance and abiotic stress tolerance signaling pathways. Acts as a positive regulator of drought, salt and cold tolerance. Negatively modulates pathogenesis-related (PR) gene expression and broad-spectrum disease resistance (PubMed:12615946). Functions downstream of CPK18 in a signaling pathway that represses defense gene expression and negatively regulates resistance to rice blast fungus. Phosphorylated by CPK18 at Thr-14 and Thr-32 and activated independently of MAP kinase kinase (MKK) phosphorylation (PubMed:25035404). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rice MPK5 Antibody is a mouse antibody against MPK5. It can be used for MPK5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMitogen-activated protein kinase 5; MAP kinase 5; EC 2.7.11.24; Benzothiadiazole-induced MAP kinase 1; MAP kinase 2; Multiple stress-responsive MAP kinase 2; OsBIMK1; OsMAP1; OsMAPK2; OsMAPK5; OsMPK3; OsMSRMK2; MPK5; BIMK1 MAPK2 MAPK5 MPK3 MSRMK2; Os03g0285800 LOC_Os03g17700
UniProt IDQ10N20
Protein RefseqThe length of the protein is 369 amino acids long.
The sequence is show below: MDGAPVAEFRPTMTHGGRYLLYDIFGNKFEVTNKYQPPIMPIGRGAYGIVCSVMNFETREMVAIKKIANAFNNDMDAKRTLREIKLLRHLDHENIIGIRDVIPPPIPQAFNDVYIATELMDTDLHHIIRSNQELSEEHCQYFLYQILRGLKYIHSANVIHRDLKPSNLLLNANCDLKICDFGLARPSSESDMMTEYVVTRWYRAPELLLNSTDYSAAIDVWSVGCIFMELINRQPLFPGRDHMHQMRLITEVIGTPTDDELGFIRNEDARKYMRHLPQYPRRTFASMFPRVQPAALDLIERMLTFNPLQRITVEEALDHPYLERLHDIADEPICLEPFSFDFEQKALNEDQMKQLIFNEAIEMNPNIRY.
For Research Use Only | Not For Clinical Use.
Online Inquiry