AibGenesis™ Mouse Anti-mplkip Antibody (CBMOAB-87258FYA)


Cat: CBMOAB-87258FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-87258FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO87258FYA 100 µg
MO-AB-15939R Monoclonal Cattle (Bos taurus) WB, ELISA MO15939R 100 µg
MO-AB-22290W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22290W 100 µg
MO-AB-27164H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27164C 100 µg
MO-AB-59267W Monoclonal Marmoset WB, ELISA MO59267W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO87258FYA
SpecificityThis antibody binds to Zebrafish mplkip.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene localizes to the centrosome during mitosis and to the midbody during cytokinesis. The protein is phosphorylated by cyclin-dependent kinase 1 during mitosis and subsequently interacts with polo-like kinase 1. The protein is thought to function in regulating mitosis and cytokinesis. Mutations in this gene result in nonphotosensitive trichothiodystrophy. (From NCBI)
Product OverviewMouse Anti-Zebrafish mplkip Antibody is a mouse antibody against mplkip. It can be used for mplkip detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesmplkip; si:ch211-202i17.3; M-Phase Specific PLK1 Interacting Protein
UniProt IDB0V0W7
Protein RefseqThe length of the protein is 178 amino acids long.
The sequence is show below: MQRPQFRHPRPGSGPRPAGFRSPPPAFDRTGSMFPSPPWAYSTPPPPFGPRFGQCSPNTPPREYGGNRSSSGGGGKYFNDQSPGHTPRRANPSPRGAPFRRSPYESPGRHSGYQGSPRTSTPFGSAHGRDRGTNDMEKYYKPSMLQDPWADLQPISVTQTQSKTSKQSDTSRQGRYYN.
For Research Use Only | Not For Clinical Use.
Online Inquiry