Mouse Anti-mrc1 Antibody (MO-AB-05289H)


Cat: MO-AB-05289H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-05289H Monoclonal Frog (Xenopus laevis), Pig (Sus scrofa), Rhesus (Macaca mulatta), Yeast WB, ELISA MO05289C 100 µg
CBMOAB-51671FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO51671FYA 100 µg
CBMOAB-02370CR Monoclonal Yeast WB, ELISA MO02370CR 100 µg
MO-AB-27361R Monoclonal Pig (Sus scrofa) WB, ELISA MO27361R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis), Pig (Sus scrofa), Rhesus (Macaca mulatta), Yeast
CloneMO05289C
SpecificityThis antibody binds to Frog mrc1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe recognition of complex carbohydrate structures on glycoproteins is an important part of several biological processes, including cell-cell recognition, serum glycoprotein turnover, and neutralization of pathogens. The protein encoded by this gene is a type I membrane receptor that mediates the endocytosis of glycoproteins by macrophages. The protein has been shown to bind high-mannose structures on the surface of potentially pathogenic viruses, bacteria, and fungi so that they can be neutralized by phagocytic engulfment.
Product OverviewThis product is a mouse antibody against mrc1. It can be used for mrc1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMrc1-prov protein; mrc1; mrc1-prov
UniProt IDQ6DDD6
Protein RefseqThe length of the protein is 144 amino acids long.
The sequence is show below: MASLPVCPPFPCPEKWFEFTGHCYYITNTLKSWDGAKTTCEKMNSHLIMINSLEEQEFAVEFAVQKTTWIGLSDADGEWKWVDKTPLDWNQTYWREGQPDDWTGHGKGGGEDCAQIAYDQKWNDEQCNKPYQFICEKEQRNWRK.
For Research Use Only | Not For Clinical Use.
Online Inquiry