AibGenesis™ Mouse Anti-Mrpl20 Antibody (MO-AB-27196H)
Cat: MO-AB-27196H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-27196H | Monoclonal | Rat (Rattus norvegicus), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Fruit fly (Drosophila melanogaster), Marmoset, Rhesus (Macaca mulatta), Yeast, Zebrafish (Danio rerio) | WB, ELISA | MO27196C | 100 µg | ||
| CBMOAB-24696FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO24696FYA | 100 µg | ||
| CBMOAB-51712FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO51712FYA | 100 µg | ||
| CBMOAB-87372FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO87372FYA | 100 µg | ||
| CBMOAB-02400CR | Monoclonal | Yeast | WB, ELISA | MO02400CR | 100 µg | ||
| CBMOAB-06811HCB | Monoclonal | C. elegans (Caenorhabditis elegans) | WB, ELISA | MO06811HB | 100 µg | ||
| MO-AB-25990W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO25990W | 100 µg | ||
| MO-AB-59332W | Monoclonal | Marmoset | WB, ELISA | MO59332W | 100 µg | ||
| MO-AB-15995R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO15995R | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rat (Rattus norvegicus), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Fruit fly (Drosophila melanogaster), Marmoset, Rhesus (Macaca mulatta), Yeast, Zebrafish (Danio rerio) |
| Clone | MO27196C |
| Specificity | This antibody binds to Rat Mrpl20. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. A pseudogene corresponding to this gene is found on chromosome 21q. Alternative splicing results in multiple transcript variants encoding different isoforms. (From NCBI) |
| Product Overview | This product is a mouse antibody against Mrpl20. It can be used for Mrpl20 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Mitochondrial ribosomal protein L20; Protein Mrpl20; RCG30918, isoform CRA_a; Mrpl20 |
| UniProt ID | B2GV62 |
| Protein Refseq | The length of the protein is 149 amino acids long. The sequence is show below: MVFLTTRLWLRNRLTDRYWRVQEVLKHAGHFRGRKNRCYRLAVRAVTRAFVKCTNSRRLKKRNLRTLWINRITAASQEHGLQYPAFILNLVKCQVELNRKVLVDLAIYEPKTFKSLAALAKRRQQEGFAAALGDGKEPEGIFSRVVQYH. |
For Research Use Only | Not For Clinical Use.
Online Inquiry