AibGenesis™ Mouse Anti-MRPL53 Antibody (CBMOAB-06835HCB)
Cat: CBMOAB-06835HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-06835HCB | Monoclonal | C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) | WB, ELISA | MO06835HB | 100 µg | ||
| CBMOAB-24742FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO24742FYA | 100 µg | ||
| CBMOAB-51749FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO51749FYA | 100 µg | ||
| MO-AB-05314H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO05314C | 100 µg | ||
| MO-AB-10414W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO10414W | 100 µg | ||
| MO-AB-16030R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO16030R | 100 µg | ||
| MO-AB-27219H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO27219C | 100 µg | ||
| MO-AB-35145W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO35145W | 100 µg | ||
| MO-AB-59362W | Monoclonal | Marmoset | WB, ELISA | MO59362W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) |
| Clone | MO06835HB |
| Specificity | This antibody binds to C. elegans MRPL53. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. A pseudogene corresponding to this gene is found on chromosome 1p. (From NCBI) |
| Product Overview | Mouse Anti-C. elegans MRPL53 Antibody is a mouse antibody against MRPL53. It can be used for MRPL53 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Protein MRPL-53; mrpl-53 |
| UniProt ID | Q7YX52 |
| Protein Refseq | The length of the protein is 129 amino acids long. The sequence is show below: MSQLWSKIRYGVRWNPAERLALATRALNLQKVKSIDISLDPLHHDNLSIRTFWHSIMAPKVRLTNPNVRVKTDIRNDRRAPFFVATLDDGQKLHFSTENMTAMDVIMNFNRLTGQPELGKAGTRPRAKI. |
For Research Use Only | Not For Clinical Use.
Online Inquiry