Mouse Anti-Mrpl55 Antibody (CBMOAB-24745FYA)
Cat: CBMOAB-24745FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-24745FYA | Monoclonal | Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) | WB, ELISA | MO24745FYA | 100 µg | ||
| CBMOAB-51752FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO51752FYA | 100 µg | ||
| MO-AB-59363W | Monoclonal | Marmoset | WB, ELISA | MO59363W | 100 µg | ||
| MO-AB-16033R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO16033R | 100 µg | ||
| MO-AB-27221H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO27221C | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) |
| Clone | MO24745FYA |
| Specificity | This antibody binds to fruit fly Mrpl55. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. Multiple transcript variants encoding two different isoforms were identified through sequence analysis. |
| Product Overview | Mouse Anti-D. melanogaster Mrpl55 Antibody is a mouse antibody against Mrpl55. It can be used for Mrpl55 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | 39S ribosomal protein L55, mitochondrial; L55mt; MRP-L55; mRpL55 |
| UniProt ID | Q9VE04 |
| Protein Refseq | The length of the protein is 107 amino acids long. The sequence is show below: MLLKQLPQAVQQIRCISSATTAVTRLHRSVYCRLYPTVVVQPDGSTINIRYHEPRKIIKLPLDLSTLTDAERRARLEARKPRKKVKIMEEVEDNFNAKKYMKYIKKK. |
See other products for " MRPL55 "
| CBMOAB-06837HCB | Mouse Anti-MRPL55 Antibody (CBMOAB-06837HCB) |
| MO-AB-11215W | Mouse Anti-MRPL55 Antibody (MO-AB-11215W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry