Mouse Anti-MRPL55 Antibody (MO-AB-11215W)


Cat: MO-AB-11215W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-11215W Monoclonal Chimpanzee (Pan troglodytes), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO11215W 100 µg
CBMOAB-51752FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO51752FYA 100 µg
MO-AB-59363W Monoclonal Marmoset WB, ELISA MO59363W 100 µg
MO-AB-16033R Monoclonal Cattle (Bos taurus) WB, ELISA MO16033R 100 µg
MO-AB-27221H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27221C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO11215W
SpecificityThis antibody binds to Chimpanzee MRPL55.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. Multiple transcript variants encoding two different isoforms were identified through sequence analysis.
Product OverviewMouse Anti-Chimpanzee MRPL55 Antibody is a mouse antibody against MRPL55. It can be used for MRPL55 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMitochondrial ribosomal protein L55; MRPL55
UniProt IDK7AP45
Protein RefseqThe length of the protein is 128 amino acids long.
The sequence is show below: MAAVGSLLGRLRQSTVKATGPALRRLHASSWRADSSRASLTRVHRQAYARLYPVLLVKQDGSTIHIRYREPRRMLAMPIDLDTLSLEERRARLRKREAQLQSRKEYEQELSDDLHVERYRQFWTRTKK.
For Research Use Only | Not For Clinical Use.
Online Inquiry