AibGenesis™ Mouse Anti-MRPS11 Antibody (CBMOAB-06840HCB)
Cat: CBMOAB-06840HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-06840HCB | Monoclonal | C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Fruit fly (Drosophila melanogaster), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ELISA | MO06840HB | 100 µg | ||
| CBMOAB-24750FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO24750FYA | 100 µg | ||
| CBMOAB-87429FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO87429FYA | 100 µg | ||
| MO-AB-16041R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO16041R | 100 µg | ||
| MO-AB-22089W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO22089W | 100 µg | ||
| MO-AB-27225H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO27225C | 100 µg | ||
| MO-AB-35146W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO35146W | 100 µg | ||
| MO-AB-59365W | Monoclonal | Marmoset | WB, ELISA | MO59365W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Fruit fly (Drosophila melanogaster), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) |
| Clone | MO06840HB |
| Specificity | This antibody binds to C. elegans MRPS11. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that contains a high level of sequence similarity with ribosomal protein S11P family members. A pseudogene corresponding to this gene is found on chromosome 20. Multiple transcript variants encoding different isoforms have been found for this gene. (From NCBI) |
| Product Overview | Mouse Anti-C. elegans MRPS11 Antibody is a mouse antibody against MRPS11. It can be used for MRPS11 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Protein MRPS-11; mrps-11 |
| UniProt ID | Q23155 |
| Protein Refseq | The length of the protein is 208 amino acids long. The sequence is show below: MSLRRLVSDLGRMCLQTASQSMEIQQNRAIHASIRAADSIRDAHRQGTRIGTGQVETMEGTTGAGIQTAVNTSSIDARLPTAETLKQQFDGVAYHELPLVYIRASKNNTLVTVMDNKNEVITSTSCRLEGFKNARKKTTIAGQTTGVAAGQRLVRRGIRTVRVQVKGLGPGRMTCVKGLTVAGVHVVSISDHTPLCELGPRPRKIRRI. |
For Research Use Only | Not For Clinical Use.
Online Inquiry